Recombinant Pig Platelet Factor 4 (PF4) Protein (His&Myc)
Product Overview Description Recombinant Pig Platelet Factor 4 (PF4) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P30034 Target Symbol PF4 Species Sus scrofa (Pig) Expression System E.coli Tag N-10His&C-Myc Target Protein Sequence QEWSLPGTRVPPPADPEGGDANLRCVCVKTISGVSPKHISSLEVIGAGPHCPSPQLIATLKKGHKICLDPQNLLYKKIIKKLLKSQLLTA Expression Range 1-90aa Protein Length Full Length Mol. Weight 17.1 kDa Research Area Cardiovascular Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.