Recombinant Rat Apolipoprotein C-I (APOC1) Protein (hFc)

Recombinant Rat Apolipoprotein C-I (APOC1) Protein (hFc)

$1,116.00
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Rat Apolipoprotein C-I (APOC1) Protein (hFc) is produced by our Mammalian cell expression system. This is a full length protein. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb P19939 Target Symbol APOC1 Synonyms Apoc1Apolipoprotein C-I; Apo-CI; ApoC-I; Apolipoprotein C1; Liver regeneration-related protein LRRG04) [Cleaved into: Truncated apolipoprotein C-I] Species Rattus norvegicus (Rat) Expression System Mammalian cell Tag C-hFc Target Protein Sequence APDFSSAMESLPDKLKEFGNTLEDKARAAIEHIKQKEIMIKTRNWFSETLNKMKEKLKTTFA Expression Range 27-88aa Protein Length Full Length of Mature Protein Mol. Weight 34.7 kDa Research Area Cardiovascular Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly ce

Show More Show Less