Recombinant IL-5, Human (CHO-expressed) - BK0249
Recombinant IL-5, Human (CHO-expre Ssed) Catalogue Numbers: BK0249-10, BK0249-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: ~29-35 kDa, observed by non-reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50 < 1 ng/ml, measured in a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 1×10ˆ6 units/mg. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQt VQGGt VERLFKNLSLIKKYID GQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant human Interlerkin 5 (rhIL-5) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C