Recombinant Human Cathepsin F Protein (CTSF) Protein (His)

Product Overview Description Recombinant Human Cathepsin F Protein (CTSF) Protein (His) is produced by our E.coli expression system. This is a protein fragment. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb Q9UBX1 Target Symbol CTSF Synonyms AI481912; CATF_HUMAN; Cathepsin F; CathepsinF; CATSF; CLN13; Ctsf; EC 3.4.22.41 Species Homo sapiens (Human) Expression System E.coli Tag N-6His Target Protein Sequence PEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD Expression Range 273-484aa Protein Length Partial Mol. Weight 27.4kDa Research Area Immunology Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. Target Details Target Function Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis. Subcellular Location Lysosome. Protein Families Peptidase C1 family Database References HGNC: 2531 OMIM: 603539 KEGG: hsa:8722 STRING: 9606.ENSP00000310832 UniGene: Hs.11590 Associated Diseases Ceroid lipofuscinosis, neuronal, 13 (CLN13) Tissue Specificity High expression levels in heart, skeletal muscle, brain, testis and ovary; moderate levels in prostate, placenta, liver and colon; and no detectable expression in peripheral leukocytes and thymus. Gene Functions References The CTSF gene may function as a tumor suppressor in gastric cancer PMID: 28474574 Biallelic mutations in this gene have been shown to cause Type B Kufs disease, an adult-onset neuronal ceroid lipofuscinosis with some cases resembling the impairment seen in AD. PMID: 27524508 Disease-causing cathepsin-F mutants fail to cleave LIMP-2. Our findings provide evidence that LIMP-2 represents an in vivo substrate of cathepsin-F with relevance for understanding the pathophysiology of type-B-Kufs-disease. PMID: 25576872 Small hairpin RNA silencing of proteinases overexpressed in diabetic corneas enhanced corneal epithelial and stem cell marker staining and accelerated wound healing. PMID: 24255036 Homozygous and compound heterozygous missense mutations in CTSF are associated with adult-onset neuronal ceroid lipofuscinosis. PMID: 23297359 cathepsin F has a role in modifying low density lipoprotein particles PMID: 15184381 cathepsin F, matrix metalloproteinases 11 and 12 are upregulated in cervical cancer PMID: 15989693 data demonstrate a novel proatherogenic role for AngII, namely its ability to enhance secretion of lysosomal cathepsin F by monocyte-derived macrophages PMID: 16963053